|
Gene id |
259240 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
WFDC9 Gene UCSC Ensembl |
|
Aliases |
WAP9, dJ688G8.2 |
|
Gene name |
WAP four-disulfide core domain 9 |
|
Alternate names |
protein WFDC9, |
|
Gene location |
20q13.12 (45631283: 45607938) Exons: 5 NC_000020.11
|
|
Gene summary(Entrez) |
The WAP-type four-disulfide core (WFDC) domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many members of the WFDC domain family. This gene encodes a
|
Protein Summary
|
| Protein general information
| Q8NEX5
Name: Protein WFDC9
Length: 89 Mass: 10506
|
| Sequence |
MKPWILLLVMFISGVVMLLPVLGSFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTCVRPNHTCCWTYCGNI CLDNEEPLKSMLNP
|
| Structural information |
|
| Other Databases |
GeneCards: WFDC9  Malacards: WFDC9 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0004867 |
serine-type endopeptidase inhibitor activity
|
IBA |
molecular function |
GO:0045087 |
innate immune response
|
IBA |
biological process |
GO:0019731 |
antibacterial humoral res ponse
|
IBA |
biological process |
GO:0005615 |
extracellular space
|
IBA |
cellular component |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0010951 |
negative regulation of en dopeptidase activity
|
IEA |
biological process |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|