Search Result
| Gene id | 259236 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | TMIE Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | DFNB6 | ||||||||||||||||||||||||||||||||
| Gene name | transmembrane inner ear | ||||||||||||||||||||||||||||||||
| Alternate names | transmembrane inner ear expressed protein, transmembrane inner ear protein, | ||||||||||||||||||||||||||||||||
| Gene location |
3p21.31 (46693777: 46710885) Exons: 5 NC_000003.12 |
||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multip |
||||||||||||||||||||||||||||||||
| OMIM | 176870 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q8NEW7 Name: Transmembrane inner ear expressed protein Length: 156 Mass: 17241 Tissue specificity: Expressed in many tissues. {ECO | ||||||||||||||||||||||||||||||||
| Sequence |
MAGWPGAGPLCVLGGAALGVCLAGVAGQLVEPSTAPPKPKPPPLTKETVVFWDMRLWHVVGIFSLFVLSIIITLC CVFNCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKKDSVDTVAIKVEEDEKNEAK KKKGEK | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TMIE  Malacards: TMIE | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||