• Gene id: 25901

Gene Summary

• Gene Symbol: CCDC28A   Gene   UCSC   Ensembl
• Aliases: C6orf80, CCRL1AP
• Gene name: coiled-coil domain containing 28A
• Alternate names: coiled-coil domain-containing protein 28A, chemokine C-C motif receptor-like 1 adjacent,
• Gene location: 6q24.1 (138773516: 138793318)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene encodes a coiled-coil domain containing protein. Although the specific function of this gene has not yet been determined, this gene is a known translocation partner of nucleoporin 98 in acute leukemias. The resulting fusion gene produces a nucle
• OMIM: 615353

Protein Summary

• Protein general information: Q8IWP9  
  • Name: Coiled coil domain containing protein 28A (CCRL1AP)
  • Length: 274  
  • Mass: 30367
• Sequence:

  MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAVGSLRVAEGGPNTLLL
  QVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPKLKRVMKEKTK
  PQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYG
  ELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS

• Structural information:
  • Interpro: IPR025271  
  • STRING: ENSP00000479060
• Other Databases: GeneCards:  CCDC28A  Malacards:  CCDC28A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881