• Gene id: 25871

Gene Summary

• Gene Symbol: NEPRO   Gene   UCSC   Ensembl
• Aliases: ANXD3, C3orf17, NET17
• Gene name: nucleolus and neural progenitor protein
• Alternate names: nucleolus and neural progenitor protein, protein nepro homolog,
• Gene location: 3q13.2 (113019720: 113002443)     Exons: 9     NC_000003.12
• OMIM: 617089

Protein Summary

• Protein general information: Q6NW34  
  • Name: Nucleolus and neural progenitor protein
  • Length: 567  
  • Mass: 64552
• Sequence:

  MMAAVPPGLEPWNRVRIPKAGNRSAVTVQNPGAALDLCIAAVIKECHLVILSLKSQTLDAETDVLCAVLYSNHNR
  MGRHKPHLALKQVEQCLKRLKNMNLEGSIQDLFELFSSNENQPLTTKVCVVPSQPVVELVLMKVLGACKLLLRLL
  DCCCKTFLLTVKHLGLQEFIILNLVMVGLVSRLWVLYKGVLKRLILLYEPLFGLLQEVARIQPMPYFKDFTFPSD
  ITEFLGQPYFEAFKKKMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLGQPVKNK
  RVFKEESSEFDVRAFCNQLKHKATQETSFDFKCSQSRLKTTKYSSQKVIGTPHAKSFVQRFREAESFTQLSEEIQ
  MAVVWCRSKKLKAQAIFLGNKLLKSNRLKHLEAQGTSLPKKLECIKTSICNHLLRGSGIKTSKHHLRQRRSQNKF
  LRRQRKPQRKLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNSGVSMPVIQTKEKMIHE
  NLRGIHENETDSWTVMQINKNSTSGTIKETDDIDDIFALMGV

• Structural information:
  • Interpro: IPR027951  
  • STRING: ENSP00000320251
• Other Databases: GeneCards:  NEPRO  Malacards:  NEPRO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045747	positive regulation of Notch signaling pathway	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0005730	nucleolus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0045665	negative regulation of neuron differentiation	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)