• Gene id: 25850

Gene Summary

• Gene Symbol: ZNF345   Gene   UCSC   Ensembl
• Aliases: HZF10
• Gene name: zinc finger protein 345
• Alternate names: zinc finger protein 345, zinc finger protein HZF10,
• Gene location: 19q13.12 (36850349: 36893217)     Exons: 9     NC_000019.10
• OMIM: 605381

Protein Summary

• Protein general information: Q14585  
  • Name: Zinc finger protein 345 (Zinc finger protein HZF10)
  • Length: 488  
  • Mass: 55383
• Sequence:

  MENLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSEMIFTPEDMPTFSIQHQRIHTDEKLLECKECGKDFSFVS
  VLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQRIHTGEKPFECKECGKAFGSGSNLTHHQRIHTGEKPYECKE
  CGKAFSFGSGLIRHQIIHSGEKPYECKECGKSFSFESALIRHHRIHTGEKPYECIDCGKAFGSGSNLTQHRRIHT
  GEKPYECKACGMAFSSGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSD
  LTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKTFSSGSDLTQHHRIHTGEKPYECKEC
  GKAFGSGSKLIQHQLIHTGERPYECKECGKSFSSGSALNRHQRIHTGEKPYECKECGKAFYSGSSLTQHQRIHTG
  EKLYECKNCGKAYGRDSEFQQHKKSHNGKKLCELETIN

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000431202
• Other Databases: GeneCards:  ZNF345  Malacards:  ZNF345

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006359	regulation of transcription by RNA polymerase III	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006383	transcription by RNA polymerase III	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881