Search Result
| Gene id | 25823 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | TPSG1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | PRSS31, TMT, trpA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | tryptase gamma 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | tryptase gamma, serine protease 31, transmembrane tryptase, tryptase gamma I, tryptase gamma II, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
16p13.3 (131635228: 131423920) Exons: 31 NC_000005.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 609341 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9NRR2 Name: Tryptase gamma (EC 3.4.21. ) (Serine protease 31) (Transmembrane tryptase) [Cleaved into: Tryptase gamma light chain; Tryptase gamma heavy chain] Length: 321 Mass: 33815 Tissue specificity: Expressed in many tissues. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLT AAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEAS DDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGP LVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSC VLLAKCLLHPSADGTPFPAPD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TPSG1  Malacards: TPSG1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||