|
Gene id |
25817 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
TAFA5 Gene UCSC Ensembl |
|
Aliases |
FAM19A5, QLLK5208, TAFA-5, UNQ5208 |
|
Gene name |
TAFA chemokine like family member 5 |
|
Alternate names |
chemokine-like protein TAFA-5, TAFA protein 5, family with sequence similarity 19 (chemokine (C-C motif)-like), member A5, family with sequence similarity 19 member A5, C-C motif chemokine like, protein FAM19A5, |
|
Gene location |
22q13.32 (48489552: 48751931) Exons: 13 NC_000022.11
|
|
Gene summary(Entrez) |
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
|
|
OMIM |
617499 |
Protein Summary
|
| Protein general information
| Q7Z5A7
Name: Chemokine like protein TAFA 5
Length: 132 Mass: 14301
Tissue specificity: Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed
|
| Sequence |
MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQI AGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
|
| Structural information |
|
| Other Databases |
GeneCards: TAFA5  Malacards: TAFA5 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005125 |
cytokine activity
|
IEA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005615 |
extracellular space
|
IEA |
cellular component |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0007165 |
signal transduction
|
IEA |
biological process |
|
|
| Associated diseases |
References |
| Cryptorchidism | MIK: 28606200 |
| Spermatogenic defects | MIK: 31037746 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|