Search Result
| Gene id | 25789 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | TMEM59L Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Aliases | BSMAP, C19orf4 | ||||||||||||||||||||||||||||
| Gene name | transmembrane protein 59 like | ||||||||||||||||||||||||||||
| Alternate names | transmembrane protein 59-like, brain-specific membrane-anchored protein, | ||||||||||||||||||||||||||||
| Gene location |
19p13.11 (18612869: 18621039) Exons: 7 NC_000019.10 |
||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a predicted type-I membrane glycoprotein. The encoded protein may play a role in functioning of the central nervous system. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||
| OMIM | 610089 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | Q9UK28 Name: Transmembrane protein 59 like (Brain specific membrane anchored protein) Length: 342 Mass: 37619 Tissue specificity: Expressed preferentially at high level in the brain. | ||||||||||||||||||||||||||||
| Sequence |
MAAVALMPPPLLLLLLLASPPAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLIS ACERGCRLFSICRFVARSSKPNATQTECEAACVEAYVKEAEQQACSHGCWSQPAEPEPEQKRKVLEAPSGALSLL DLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEALEVHVDPVG PLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSRRSGLPRWILACCLFLSVLVMLWLSCSTLVTAPGQHLKFQ PLTLEQHKGFMMEPDWPLYPPPSHACEDSLPPYKLKLDLTKL | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: TMEM59L  Malacards: TMEM59L | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||