• Gene id: 25780

Gene Summary

• Gene Symbol: RASGRP3   Gene   UCSC   Ensembl
• Aliases: GRP3
• Gene name: RAS guanyl releasing protein 3
• Alternate names: ras guanyl-releasing protein 3, CalDAG-GEFIII, RAS guanyl releasing protein 3 (calcium and DAG-regulated), calcium and DAG-regulated guanine nucleotide exchange factor III, calcium- and diacylglycerol-regulated guanine nucleotide exchange factor III, guanine n,
• Gene location: 2p22.3 (33436347: 33564730)     Exons: 25     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017]
• OMIM: 609531

Protein Summary

• Protein general information: Q8IV61  
  • Name: Ras guanyl releasing protein 3 (Calcium and DAG regulated guanine nucleotide exchange factor III) (Guanine nucleotide exchange factor for Rap1)
  • Length: 690  
  • Mass: 78332
• Sequence:

  MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKIC
  YFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDH
  LEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKF
  INVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
  ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYK
  LSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAA
  NFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKC
  KDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
  ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFEL
  DQDEGEETRQDGEDG

• Structural information:
  • Protein Domains: (3..12-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (152..38-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (420..45-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRu-)
  • Interpro: IPR020454  IPR011992  IPR018247  IPR002048  IPR002219   IPR008937  IPR000651  IPR023578  IPR001895  IPR036964  IPR029645  
  • Prosite: PS00018 PS50222 PS50009 PS50212 PS00479 PS50081
  • CDD: cd00029 cd00051 cd00155 cd06224
  • STRING: ENSP00000384192
• Other Databases: GeneCards:  RASGRP3  Malacards:  RASGRP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0017016	Ras GTPase binding	IEA	molecular function
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0032045	guanyl-nucleotide exchange factor complex	IEA	cellular component
GO:0019900	kinase binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0019992	diacylglycerol binding	NAS	molecular function
GO:0000165	MAPK cascade	NAS	biological process
GO:0005509	calcium ion binding	NAS	molecular function
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Hypertension	PMID:19421330
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray