• Gene id: 25759

Gene Summary

• Gene Symbol: SHC2   Gene   UCSC   Ensembl
• Aliases: SCK, SHCB, SLI
• Gene name: SHC adaptor protein 2
• Alternate names: SHC-transforming protein 2, SH2 domain protein C2, SHC (Src homology 2 domain containing) transforming protein 2, SHC-transforming protein B, neuronal Shc adaptor homolog, protein Sck, src homology 2 domain-containing-transforming protein C2,
• Gene location: 19p13.3 (461010: 416582)     Exons: 16     NC_000019.10
• OMIM: 607643

Protein Summary

• Protein general information: P98077  
  • Name: SHC transforming protein 2 (Protein Sck) (SHC transforming protein B) (Src homology 2 domain containing transforming protein C2) (SH2 domain protein C2)
  • Length: 582  
  • Mass: 61916
  • Tissue specificity: Expressed in brain. Expressed at high level in the hypothalamus and at low level in the caudate nucleus. {ECO
• Sequence:

  MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGADPQPEPAGPGGVPAL
  AAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAAAAAEWIRKGSFIHKPAHGWLHPDARVLGPG
  VSYVVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIH
  ISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
  RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALTQPCALTALDQGPSPS
  LRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSV
  AAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMH
  AGQPKHLLLVDPEGVVRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP

• Structural information:
  • Protein Domains: (147..32-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148-)
    (487..57-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR011993  IPR006019  IPR006020  IPR000980  IPR036860   IPR029591  IPR035676  
  • Prosite: PS01179 PS50001
  • CDD: cd01209 cd09925
  • STRING: ENSP00000264554
• Other Databases: GeneCards:  SHC2  Malacards:  SHC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05034	Alcoholism
hsa05225	Hepatocellular carcinoma
hsa04072	Phospholipase D signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04012	ErbB signaling pathway
hsa01522	Endocrine resistance
hsa05100	Bacterial invasion of epithelial cells
hsa05220	Chronic myeloid leukemia
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq