• Gene id: 257144

Gene Summary

• Gene Symbol: GCSAM   Gene   UCSC   Ensembl
• Aliases: GCAT2, GCET2, HGAL
• Gene name: germinal center associated signaling and motility
• Alternate names: germinal center-associated signaling and motility protein, germinal center B-cell-expressed transcript 2 protein, germinal center expressed transcript 2, germinal center-associated lymphoma protein, human germinal center-associated lymphoma,
• Gene location: 3q13.2 (112133955: 112120838)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two pu
• OMIM: 607792

Protein Summary

• Protein general information: Q8N6F7  
  • Name: Germinal center associated signaling and motility protein (Germinal center B cell expressed transcript 2 protein) (Germinal center associated lymphoma protein) (hGAL)
  • Length: 178  
  • Mass: 21005
  • Tissue specificity: Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen. {EC
• Sequence:

  MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDN
  VDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYEL
  LMPHRISSHFLQQPRPLMAPSETQFSHL

• Structural information:
  • Interpro: IPR031364  
  • STRING: ENSP00000419485
• Other Databases: GeneCards:  GCSAM  Malacards:  GCSAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000402	negative regulation of lymphocyte migration	IMP	biological process
GO:0050855	regulation of B cell receptor signaling pathway	IMP	biological process
GO:0045159	myosin II binding	IPI	molecular function
GO:0003779	actin binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050855	regulation of B cell receptor signaling pathway	IEA	biological process
GO:2000401	regulation of lymphocyte migration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881