• Gene id: 256586

Gene Summary

• Gene Symbol: LYSMD2   Gene   UCSC   Ensembl
• Gene name: LysM domain containing 2
• Alternate names: lysM and putative peptidoglycan-binding domain-containing protein 2, LysM, putative peptidoglycan-binding, domain containing 2,
• Gene location: 15q21.2 (51751452: 51723010)     Exons: 5     NC_000015.10
• OMIM: 600242

Protein Summary

• Protein general information: Q8IV50  
  • Name: LysM and putative peptidoglycan binding domain containing protein 2
  • Length: 215  
  • Mass: 23463
• Sequence:

  MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRV
  RAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPV
  VAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS

• Structural information:
  • Protein Domains: (71..11-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118"-)
  • Interpro: IPR018392  IPR036779  
  • Prosite: PS51782
  • CDD: cd00118
  • STRING: ENSP00000267838
• Other Databases: GeneCards:  LYSMD2  Malacards:  LYSMD2

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881