• Gene id: 256435

Gene Summary

• Gene Symbol: ST6GALNAC3   Gene   UCSC   Ensembl
• Aliases: PRO7177, SIAT7C, ST6GALNACIII, STY
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
• Alternate names: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, GalNAc alpha-2,6-sialyltransferase III, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3),
• Gene location: 1p31.1 (76074733: 76637315)     Exons: 10     NC_000001.11
• Gene summary(Entrez): ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM, Mar 2008]

Protein Summary

• Protein general information: Q8NDV1  
  • Name: Alpha N acetylgalactosaminide alpha 2,6 sialyltransferase 3 (EC 2.4.99.7) (GalNAc alpha 2,6 sialyltransferase III) (ST6GalNAc III) (ST6GalNAcIII) (STY) (Sialyltransferase 7C) (SIAT7 C)
  • Length: 305  
  • Mass: 35395
• Sequence:

  MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQL
  DCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTT
  IYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLA
  MDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHP
  NWTLS

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000329214
• Other Databases: GeneCards:  ST6GALNAC3  Malacards:  ST6GALNAC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097503	sialylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0008373	sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047290	(alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008373	sialyltransferase activity	IDA	molecular function
GO:0006677	glycosylceramide metabolic process	IDA	biological process
GO:0006687	glycosphingolipid metabolic process	IDA	biological process
GO:0009100	glycoprotein metabolic process	IDA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq