• Gene id: 255119

Gene Summary

• Gene Symbol: CFAP299   Gene   UCSC   Ensembl
• Aliases: C4orf22
• Gene name: cilia and flagella associated protein 299
• Alternate names: cilia- and flagella-associated protein 299, uncharacterized protein C4orf22,
• Gene location: 4q21.21 (80321264: 80963755)     Exons: 13     NC_000004.12

Protein Summary

• Protein general information: Q6V702  
  • Name: Cilia and flagella associated protein 299
  • Length: 233  
  • Mass: 26869
• Sequence:

  MDQEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLA
  ERAQQKTLTSAGKDLQDNFLTALAMREEDNRSGKLSSVIFIRDRNSHGQEISGYIDYAHRLKTEDFEVYFTGKKR
  LLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKAQPGDNSTRITILTELYVQAVIF
  DHISRRKT

• Structural information:
  • Interpro: IPR027887  
  • STRING: ENSP00000425786
• Other Databases: GeneCards:  CFAP299  Malacards:  CFAP299

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray