• Gene id: 255057

Gene Summary

• Gene Symbol: CBARP   Gene   UCSC   Ensembl
• Aliases: BARP, C19orf26, DOS
• Gene name: CACN subunit beta associated regulatory protein
• Alternate names: voltage-dependent calcium channel beta subunit-associated regulatory protein, CACN beta subunit associated regulatory protein, VGCC beta-anchoring and -regulatory protein, calcium channel, voltage-dependent, beta subunit associated regulatory protein, downstr,
• Gene location: 19p13.3 (1238511: 1228286)     Exons: 12     NC_000019.10

Protein Summary

• Protein general information: Q8N350  
  • Name: Voltage dependent calcium channel beta subunit associated regulatory protein
  • Length: 705  
  • Mass: 73929
• Sequence:

  MQPTATMATAATTTTTTTATVALTTSWDNATGRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGVLLLCKRCWD
  VHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTSSTGRRVSFNEAALFEQSRKTQDKG
  RRYTLTEGDFHHLKNARLTHLHLPPLKIVTIHECDSGEASSATTPHPATSPKATLAIFQPPGKALTGRSVGPSSA
  LPGDPYNSAAGATDFAEISPSASSDSGEGTSLDAGTRSTKAGGPGAAAGPGEAGPGSGAGTVLQFLTRLRRHASL
  DGASPYFKVKKWKLEPSQRAASLDTRGSPKRHHFQRQRAASESTEQEEGDAPQEDFIQYIARAGDAVAFPHPRPF
  LASPPPALGRLEAAEAAGGASPDSPPERGAGSAGPEQQQPPLEPDAERDAGPEQAQTSYRDLWSLRASLELHAAA
  SDHSSSGNDRDSVRSGDSSGSGSGGAAPAFPPPSPPAPRPKDGEARRLLQMDSGYASIEGRGAGDDTEPPAAPAR
  PRSPRAWPRRPRRDYSIDEKTDALFHEFLRHDPHFDDTPAAARHRARAHPHARKQWQRGRQHSDPGARAAPALAG
  TPAPPAGAARPARAPLRRGDSVDGPPDGRTLGGAGDDPAIPVIEEEPGGGGCPGSGLCVLPSGSVLDKLAAGLDE
  RLFPPRLAEPVVATPALVAAAPTSPDHSPA

• Structural information:
  • Interpro: IPR037658  
  • STRING: ENSP00000465260
• Other Databases: GeneCards:  CBARP  Malacards:  CBARP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0030141	secretory granule	IBA	colocalizes with
GO:0044325	ion channel binding	IBA	molecular function
GO:0045955	negative regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:1901386	negative regulation of voltage-gated calcium channel activity	IBA	biological process
GO:0044325	ion channel binding	ISS	molecular function
GO:0030141	secretory granule	ISS	cellular component
GO:1901386	negative regulation of voltage-gated calcium channel activity	ISS	biological process
GO:0045955	negative regulation of calcium ion-dependent exocytosis	ISS	biological process
GO:0030426	growth cone	ISS	colocalizes with
GO:0005886	plasma membrane	ISS	cellular component
GO:1903170	negative regulation of calcium ion transmembrane transport	ISS	biological process
GO:0044325	ion channel binding	IEA	molecular function
GO:1901386	negative regulation of voltage-gated calcium channel activity	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq