• Gene id: 255022

Gene Summary

• Gene Symbol: CALHM1   Gene   UCSC   Ensembl
• Aliases: FAM26C
• Gene name: calcium homeostasis modulator 1
• Alternate names: calcium homeostasis modulator protein 1, family with sequence similarity 26, member C,
• Gene location: 10q24.33 (103458899: 103453239)     Exons: 2     NC_000010.11
• Gene summary(Entrez): This gene encodes a calcium channel that plays a role in processing of amyloid-beta precursor protein. A polymorphism at this locus has been reported to be associated with susceptibility to late-onset Alzheimer's disease in some populations, but the patho
• OMIM: 602322

Protein Summary

• Protein general information: Q8IU99  
  • Name: Calcium homeostasis modulator protein 1 (Protein FAM26C)
  • Length: 346  
  • Mass: 38264
  • Tissue specificity: Predominantly expressed in adult brain. Detected also in retinoic acid-differentiated SH-SY5Y cells. Specifically expressed in circumvallate taste bud cells. {ECO
• Sequence:

  MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAPPLVLFLLGLVMNNNV
  SMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVSALGNGSLAPGLPAP
  ELARLLARVPCPEIYDGDWLLAREVAVRYLRCISQALGWSFVLLTTLLAFVVRSVRPCFTQAAFLKSKYWSHYID
  IERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMN
  RLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV

• Structural information:
  • Interpro: IPR029569  IPR029568  
  • STRING: ENSP00000329926
• Other Databases: GeneCards:  CALHM1  Malacards:  CALHM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005261	cation channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006812	cation transport	IDA	biological process
GO:0005244	voltage-gated ion channel activity	IDA	molecular function
GO:0005244	voltage-gated ion channel activity	IDA	molecular function
GO:0005227	calcium activated cation channel activity	IDA	molecular function
GO:0051260	protein homooligomerization	IDA	biological process
GO:0034765	regulation of ion transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0015867	ATP transport	ISS	biological process
GO:0050917	sensory perception of umami taste	ISS	biological process
GO:0050916	sensory perception of sweet taste	ISS	biological process
GO:0050913	sensory perception of bitter taste	ISS	biological process
GO:0005227	calcium activated cation channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0050896	response to stimulus	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0050909	sensory perception of taste	IEA	biological process
GO:0015867	ATP transport	IEA	biological process
GO:0005245	voltage-gated calcium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0050917	sensory perception of umami taste	IEA	biological process
GO:0050916	sensory perception of sweet taste	IEA	biological process
GO:0050913	sensory perception of bitter taste	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq