Male Infertility Database

Search Result

Gene id

254531

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

LPCAT4 Gene UCSC Ensembl

Aliases

AGPAT7, AYTL3, LPAAT-eta, LPEAT2

Gene name

lysophosphatidylcholine acyltransferase 4

Alternate names

lysophospholipid acyltransferase LPCAT4, 1-AGP acyltransferase 7, 1-AGPAT 7, 1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acid acyltransferase, eta), 1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferas,

Gene location

15q14 (34367195: 34358632) Exons: 16 NC_000015.10

Gene summary(Entrez)

Members of the 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) family, such as AGPAT7, catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a precursor in the biosynthesis of all glycerolipids. Both LPA and PA are i

Protein Summary

Protein general information

Q643R3

Name: Lysophospholipid acyltransferase LPCAT4 (1 acylglycerol 3 phosphate O acyltransferase 7) (1 AGP acyltransferase 7) (1 AGPAT 7) (1 acylglycerophosphocholine O acyltransferase) (EC 2.3.1.23) (1 acylglycerophosphoserine O acyltransferase) (EC 2.3.1.n6) (1 al

Length: 524 Mass: 57219

Tissue specificity: Widely expressed with predominant level in brain. {ECO

Sequence

MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFLLWPFAWLQVAGLSEE
QLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQAPVLVAAPHSTFFDPIVLLPCDLPKVVSRA
ENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVP
VQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGA
FGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPAATA
LHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD

Structural information

Interpro:	IPR002123
STRING:	ENSP00000317300

Other Databases

GeneCards: LPCAT4 Malacards: LPCAT4

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0016746	transferase activity, tra nsferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, tra nsferring acyl groups	IEA	molecular function
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0047184	1-acylglycerophosphocholi ne O-acyltransferase acti vity	IEA	molecular function
GO:0047166	1-alkenylglycerophosphoet hanolamine O-acyltransfer ase activity	IEA	molecular function
GO:0047192	1-alkylglycerophosphochol ine O-acetyltransferase a ctivity	IEA	molecular function
GO:0006644	phospholipid metabolic pr ocess	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0071617	lysophospholipid acyltran sferase activity	IDA	molecular function
GO:0006644	phospholipid metabolic pr ocess	IMP	biological process
GO:0071617	lysophospholipid acyltran sferase activity	IMP	molecular function
GO:0036148	phosphatidylglycerol acyl -chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-c hain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0006654	phosphatidic acid biosynt hetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl- chain remodeling	TAS	biological process
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0006644	phospholipid metabolic pr ocess	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism
hsa00565	Ether lipid metabolism

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All