• Gene id: 254228

Gene Summary

• Gene Symbol: CALHM5   Gene   UCSC   Ensembl
• Aliases: C6orf188, FAM26E, dJ493F7.3
• Gene name: calcium homeostasis modulator family member 5
• Alternate names: calcium homeostasis modulator protein 5, family with sequence similarity 26 member E, protein FAM26E,
• Gene location: 6q22.1 (116511638: 116524787)     Exons: 2     NC_000006.12
• OMIM: 613619

Protein Summary

• Protein general information: Q8N5C1  
  • Name: Calcium homeostasis modulator protein 5 (Protein FAM26E)
  • Length: 309  
  • Mass: 35170
• Sequence:

  MDAFQGILKFFLNQKTVIGYSFMALLTVGSERLFSVVAFKCPCSTENMTYGLVFLFAPAWVLLILGFFLNNRSWR
  LFTGCCVNPRKIFPRGHSCRFFYVLGQITLSSLVAPVMWLSVALLNGTFYECAMSGTRSSGLLELICKGKPKECW
  EELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLICSASFFSLLTTCYARCRSKVSYLQLSFWKTYAQKEKEQ
  LENTFLDYANKLSERNLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTM
  VLVGTAHNM

• Structural information:
  • Interpro: IPR029569  IPR029572  
  • STRING: ENSP00000357588
• Other Databases: GeneCards:  CALHM5  Malacards:  CALHM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005261	cation channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881