• Gene id: 253832

Gene Summary

• Gene Symbol: ZDHHC20   Gene   UCSC   Ensembl
• Aliases: 4933421L13Rik, DHHC-20, DHHC20
• Gene name: zinc finger DHHC-type palmitoyltransferase 20
• Alternate names: palmitoyltransferase ZDHHC20, probable palmitoyltransferase ZDHHC20, zinc finger DHHC domain-containing protein 20, zinc finger DHHC-type containing 20,
• Gene location: 13q12.11 (21459369: 21372570)     Exons: 20     NC_000013.11
• OMIM: 617972

Protein Summary

• Protein general information: Q5W0Z9  
  • Name: Palmitoyltransferase ZDHHC20 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 20) (DHHC 20)
  • Length: 365  
  • Mass: 42278
• Sequence:

  MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFT
  SPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCIL
  KMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVL
  SLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD
  PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN

• Structural information:
  • Protein Domains: (126..17-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • PDB: 6BML 6BMM 6BMN
  • PDBsum: 6BML 6BMM 6BMN
  • STRING: ENSP00000371905
• Other Databases: GeneCards:  ZDHHC20  Malacards:  ZDHHC20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0030173	integral component of Golgi membrane	IMP	cellular component
GO:0016409	palmitoyltransferase activity	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq