Search Result
| Gene id | 253512 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SLC25A30 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | KMCP1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | solute carrier family 25 member 30 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | kidney mitochondrial carrier protein 1, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
13q14.13 (45434015: 45393315) Exons: 13 NC_000013.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Although the outer mitochondrial membrane is permeable to many small metabolites, transport of solutes across the inner mitochondrial membrane is achieved by members of the mitochondrial carrier protein family, such as SLC25A30 (Haguenauer et al., 2005 [P |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 610793 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q5SVS4 Name: Kidney mitochondrial carrier protein 1 (Solute carrier family 25 member 30) Length: 291 Mass: 32475 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPA MLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFM NIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVR TRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SLC25A30  Malacards: SLC25A30 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||