Search Result
| Gene id | 253017 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | TECRL Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CPVT3, GPSN2L, SRD5A2L2, TERL | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | trans-2,3-enoyl-CoA reductase like | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | trans-2,3-enoyl-CoA reductase-like, glycoprotein, synaptic 2-like, steroid 5 alpha-reductase 2-like 2, steroid 5-alpha-reductase 2-like 2 protein, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
4q13.1 (64409509: 64276297) Exons: 37 NC_000004.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene contains a ubiquitin-like domain in the N-terminal region, three transmembrane segments and a C-terminal 3-oxo-5-alpha steroid 4-dehydrogenase domain. The protein belongs to the steroid 5-alpha reductase family. Mutations |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 617242 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q5HYJ1 Name: Trans 2,3 enoyl CoA reductase like (EC 1.3.1. ) (Steroid 5 alpha reductase 2 like 2 protein) Length: 363 Mass: 42009 Tissue specificity: Predominantly expressed in the heart and skeletal muscle. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MFKRHKSLASERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTRKQICI LDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQVSWTTVFLAE YTGPLLIYLLFYLRIPCIYDGKESARRLRHPVVHLACFCHCIHYIRYLLETLFVHKVSAGHTPLKNLIMSCAFYW GFTSWIAYYINHPLYTPPSFGNRQITVSAINFLICEAGNHFINVMLSHPNHTGNNACFPSPNYNPFTWMFFLVSC PNYTYEIGSWISFTVMTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFNSYIHRKSAMIPFIL | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TECRL  Malacards: TECRL | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||