• Gene id: 2527

Gene Summary

• Gene Symbol: FUT5   Gene   UCSC   Ensembl
• Aliases: FUC-TV
• Gene name: fucosyltransferase 5
• Alternate names: alpha-(1,3)-fucosyltransferase 5, alpha (1,3) fucosyltransferase, fucT-V, fucosyltransferase V, galactoside 3-L-fucosyltransferase,
• Gene location: 19p13.3 (5870539: 5865825)     Exons: 2     NC_000019.10
• OMIM: 136835

Protein Summary

• Protein general information: Q11128  
  • Name: Alpha (1,3) fucosyltransferase 5 (EC 2.4.1.65) (Fucosyltransferase 5) (Fucosyltransferase V) (Fuc TV) (FucT V) (Galactoside 3 L fucosyltransferase)
  • Length: 374  
  • Mass: 43008
  • Tissue specificity: Liver, colon and testis and trace amounts in T-cells and brain.
• Sequence:

  MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPNGSRCQDSMATPAHPT
  LLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSM
  ESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQS
  LQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPP
  DAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQQESRYQTVRSIAAWFT

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000466880
• Other Databases: GeneCards:  FUT5  Malacards:  FUT5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IBA	molecular function
GO:0036065	fucosylation	IBA	biological process
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0017060	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0008417	fucosyltransferase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function
GO:0005794	Golgi apparatus	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq