Search Result
| Gene id | 246181 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | AKR7L Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | AFAR3, AFB1-AR 3, AFB1-AR3, AKR7A4 | ||||||||||||||||||||||||
| Gene name | aldo-keto reductase family 7 like (gene/pseudogene) | ||||||||||||||||||||||||
| Alternate names | aflatoxin B1 aldehyde reductase member 4, AFB1 aldehyde reductase 3, aldo-keto reductase family 7 pseudogene, aldo-keto reductase family 7-like, aldoketoreductase 7-like, | ||||||||||||||||||||||||
| Gene location |
1p35-p36.1 (19274121: 19265981) Exons: 7 NC_000001.11 |
||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is one of three aldo-keto reductase genes that are present in a cluster on the p arm of chromosome 1. The encoded proteins are involved in the reduction of the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialco |
||||||||||||||||||||||||
| OMIM | 600912 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q8NHP1 Name: Aflatoxin B1 aldehyde reductase member 4 (EC 1. . . ) (AFB1 aldehyde reductase 3) (AFB1 AR 3) (Aldoketoreductase 7 like) Length: 331 Mass: 36970 Tissue specificity: Mainly expressed in uterus. {ECO | ||||||||||||||||||||||||
| Sequence |
MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDCRVKIA TKANPWIGNSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVELGLSNYAAWEV AEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFG TQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA AAEEGPLEPAVVDAFNQAWHLFAHECPNYFI | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: AKR7L  Malacards: AKR7L | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||