• Gene id: 23768

Gene Summary

• Gene Symbol: FLRT2   Gene   UCSC   Ensembl
• Gene name: fibronectin leucine rich transmembrane protein 2
• Alternate names: leucine-rich repeat transmembrane protein FLRT2, fibronectin-like domain-containing leucine-rich transmembrane protein 2,
• Gene location: 14q31.3 (85527371: 85654427)     Exons: 12     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the fibronectin leucine rich transmembrane (FLRT) family of cell adhesion molecules, which regulate early embryonic vascular and neural development. The encoded type I transmembrane protein has an extracellular region consist
• OMIM: 604807

Protein Summary

• Protein general information: O43155  
  • Name: Leucine rich repeat transmembrane protein FLRT2 (Fibronectin like domain containing leucine rich transmembrane protein 2)
  • Length: 660  
  • Mass: 74049
  • Tissue specificity: Expressed in pancreas, skeletal muscle, brain, and heart. {ECO
• Sequence:

  MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQI
  NNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGV
  EDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGT
  FSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
  NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPLFTPAPS
  TASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVSWLSLFTVMAY
  KLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNT
  ASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
  EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT

• Structural information:
  • Protein Domains: (36..6-)
    (/note="LRRNT-)
    (310..36-)
    (/note="LRRCT-)
    (419..51-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR000483  IPR003961  IPR036116  IPR013783  IPR001611   IPR003591  IPR032675  IPR000372  
  • Prosite: PS50853
  • STRING: ENSP00000332879
• Other Databases: GeneCards:  FLRT2  Malacards:  FLRT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0051965	positive regulation of synapse assembly	IBA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0005104	fibroblast growth factor receptor binding	IBA	molecular function
GO:0005911	cell-cell junction	ISS	cellular component
GO:0005925	focal adhesion	ISS	colocalizes with
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0071711	basement membrane organization	ISS	biological process
GO:0061343	cell adhesion involved in heart morphogenesis	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0003007	heart morphogenesis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0003007	heart morphogenesis	IEA	biological process
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0061343	cell adhesion involved in heart morphogenesis	IEA	biological process
GO:0071711	basement membrane organization	IEA	biological process
GO:2001222	regulation of neuron migration	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050919	negative chemotaxis	IEA	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0030674	protein-macromolecule adaptor activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process
GO:0031012	extracellular matrix	NAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray