• Gene id: 23671

Gene Summary

• Gene Symbol: TMEFF2   Gene   UCSC   Ensembl
• Aliases: CT120.2, HPP1, TENB2, TPEF, TR, TR-2
• Gene name: transmembrane protein with EGF like and two follistatin like domains 2
• Alternate names: tomoregulin-2, cancer/testis antigen family 120, member 2, hyperplastic polyposis protein 1, transmembrane protein TENB2, transmembrane protein with EGF-like and two follistatin-like domains,
• Gene location: 2q32.3 (192194932: 191948299)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple s

Protein Summary

• Protein general information: Q9UIK5  
  • Name: Tomoregulin 2 (TR 2) (Hyperplastic polyposis protein 1) (Transmembrane protein with EGF like and two follistatin like domains)
  • Length: 374  
  • Mass: 41428
  • Tissue specificity: Highly expressed in adult and fetal brain, spinal cord and prostate. Expressed in all brain regions except the pituitary gland, with highest levels in amygdala and corpus callosum. Expressed in the pericryptal myofibroblasts and other
• Sequence:

  MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCK
  FDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEG
  SGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLG
  RCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
  EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGHYSSDNTTRASTRLI

• Structural information:
  • Protein Domains: (85..13-)
    (/note="Kazal-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (176..22-)
    (/note="Kazal-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (261..30-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRul-)
  • Interpro: IPR013032  IPR000742  IPR002350  IPR036058  
  • Prosite: PS00022 PS01186 PS50026 PS51465
  • PDB: 2FMW
  • PDBsum: 2FMW
  • STRING: ENSP00000272771
• Other Databases: GeneCards:  TMEFF2  Malacards:  TMEFF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016358	dendrite development	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0007528	neuromuscular junction development	IBA	biological process
GO:0005604	basement membrane	IBA	cellular component
GO:0043113	receptor clustering	IBA	biological process
GO:0009888	tissue development	IBA	biological process
GO:0008045	motor neuron axon guidance	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0044319	wound healing, spreading of cells	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0051497	negative regulation of stress fiber assembly	IDA	biological process
GO:0045720	negative regulation of integrin biosynthetic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0016021	integral component of membrane	NAS	cellular component

Diseases

Associated diseases	References
Prostate cancer	PMID:16500022
Prostate cancer	PMID:16458425
Prostate cancer	PMID:15299075
urinary bladder cancer	PMID:16234815
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881