• Gene id: 23645

Gene Summary

• Gene Symbol: PPP1R15A   Gene   UCSC   Ensembl
• Aliases: GADD34
• Gene name: protein phosphatase 1 regulatory subunit 15A
• Alternate names: protein phosphatase 1 regulatory subunit 15A, growth arrest and DNA damage-inducible protein GADD34, growth arrest and DNA-damage-inducible 34, myeloid differentiation primary response protein MyD116 homolog, protein phosphatase 1, regulatory (inhibitor) subu,
• Gene location: 19q13.33 (48872391: 48876061)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless o
• OMIM: 611048

Protein Summary

• Protein general information: O75807  
  • Name: Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)
  • Length: 674  
  • Mass: 73478
• Sequence:

  MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAIPHTPW
  GRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGEREATSVPRGQGSQFADGQRAPLSPSLLIRT
  LQGSDKNPGEEKAEEEGVAEEEGVNKFSYPPSHRECCPAVEEEDDEEAVKKEAHRTSTSALSPGSKPSTWVSCPG
  EEENQATEDKRTERSKGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLK
  SWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEA
  SSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDS
  EDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPP
  RLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQ
  EELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLSQAVATPSRSSAAAAAALDLSGRRG

• Structural information:
  • Interpro: IPR019523  
  • PDB: 4XPN
  • PDBsum: 4XPN
  • STRING: ENSP00000200453
• Other Databases: GeneCards:  PPP1R15A  Malacards:  PPP1R15A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072542	protein phosphatase activator activity	IC	molecular function
GO:0008157	protein phosphatase 1 binding	IDA	molecular function
GO:0019888	protein phosphatase regulator activity	IC	molecular function
GO:0019888	protein phosphatase regulator activity	IC	molecular function
GO:0000164	protein phosphatase type 1 complex	IDA	cellular component
GO:0000164	protein phosphatase type 1 complex	IDA	cellular component
GO:0008157	protein phosphatase 1 binding	IPI	molecular function
GO:0008157	protein phosphatase 1 binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0035308	negative regulation of protein dephosphorylation	IDA	biological process
GO:0036496	regulation of translational initiation by eIF2 alpha dephosphorylation	IDA	biological process
GO:1902310	positive regulation of peptidyl-serine dephosphorylation	IDA	biological process
GO:1902310	positive regulation of peptidyl-serine dephosphorylation	IDA	biological process
GO:1902310	positive regulation of peptidyl-serine dephosphorylation	IDA	biological process
GO:0032058	positive regulation of translational initiation in response to stress	IC	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	NAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:1903898	negative regulation of PERK-mediated unfolded protein response	TAS	biological process
GO:0032516	positive regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:1903917	positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation	IDA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0070972	protein localization to endoplasmic reticulum	IMP	biological process
GO:1903917	positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation	TAS	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0000164	protein phosphatase type 1 complex	IBA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IBA	biological process
GO:0032516	positive regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0019888	protein phosphatase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881