Search Result
| Gene id | 23635 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SSBP2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | HSPC116, SOSS-B2 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | single stranded DNA binding protein 2 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | single-stranded DNA-binding protein 2, sequence-specific single-stranded-DNA-binding protein 2, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
5q14.1 (70248792: 70209443) Exons: 18 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a subunit of a protein complex that interacts with single-stranded DNA and is involved in the DNA damage response and maintenance of genome stability. The encoded protein may also play a role in telomere repair. A variant of this gene ma |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 607389 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | P81877 Name: Single stranded DNA binding protein 2 (Sequence specific single stranded DNA binding protein 2) Length: 361 Mass: 37828 Tissue specificity: Ubiquitous. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAA PERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVP GSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPT NANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGM ESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SSBP2  Malacards: SSBP2 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||