• Gene id: 23632

Gene Summary

• Gene Symbol: CA14   Gene   UCSC   Ensembl
• Aliases: CAXiV
• Gene name: carbonic anhydrase 14
• Alternate names: carbonic anhydrase 14, CA-XIV, carbonate dehydratase XIV, carbonic anhydrase XIV, carbonic dehydratase,
• Gene location: 1q21.2 (150257257: 150265861)     Exons: 11     NC_000001.11
• Gene summary(Entrez): Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption
• OMIM: 604832

Protein Summary

• Protein general information: Q9ULX7  
  • Name: Carbonic anhydrase 14 (EC 4.2.1.1) (Carbonate dehydratase XIV) (Carbonic anhydrase XIV) (CA XIV)
  • Length: 337  
  • Mass: 37668
  • Tissue specificity: High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
• Sequence:

  MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTE
  PLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEA
  AERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSV
  LWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
  CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA

• Structural information:
  • Protein Domains: (20..27-)
    (/note="Alpha-carbonic-anhydrase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01134"-)
  • Interpro: IPR001148  IPR036398  IPR023561  IPR018431  
  • Prosite: PS51144
  • PDB: 4LU3 5CJF
  • PDBsum: 4LU3 5CJF
  • STRING: ENSP00000358107
• Other Databases: GeneCards:  CA14  Malacards:  CA14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004089	carbonate dehydratase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016836	hydro-lyase activity	IBA	molecular function
GO:0006730	one-carbon metabolic process	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0004089	carbonate dehydratase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004089	carbonate dehydratase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0004089	carbonate dehydratase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015701	bicarbonate transport	TAS	biological process
GO:0004089	carbonate dehydratase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00910	Nitrogen metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)