• Gene id: 23601

Gene Summary

• Gene Symbol: CLEC5A   Gene   UCSC   Ensembl
• Aliases: CLECSF5, MDL-1, MDL1
• Gene name: C-type lectin domain containing 5A
• Alternate names: C-type lectin domain family 5 member A, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5, C-type lectin superfamily member 5, myeloid DAP12-associating lectin-1,
• Gene location: 7q34 (141947008: 141927355)     Exons: 7     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 165080

Protein Summary

• Protein general information: Q9NY25  
  • Name: C type lectin domain family 5 member A (C type lectin superfamily member 5) (Myeloid DAP12 associating lectin 1) (MDL 1)
  • Length: 188  
  • Mass: 21521
  • Tissue specificity: Highly expressed in bone marrow with lower levels in synovium, lung and bronchus (PubMed
• Sequence:

  MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDW
  EFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNG
  NVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

• Structural information:
  • Protein Domains: (78..18-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • PDB: 2YHF
  • PDBsum: 2YHF
  • DIP: 60627
  • STRING: ENSP00000449999
• Other Databases: GeneCards:  CLEC5A  Malacards:  CLEC5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0001618	virus receptor activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0002076	osteoblast development	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0033033	negative regulation of myeloid cell apoptotic process	IEA	biological process
GO:0030099	myeloid cell differentiation	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0002076	osteoblast development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881