• Gene id: 23584

Gene Summary

• Gene Symbol: VSIG2   Gene   UCSC   Ensembl
• Aliases: 2210413P10Rik, CTH, CTXL
• Gene name: V-set and immunoglobulin domain containing 2
• Alternate names: V-set and immunoglobulin domain-containing protein 2, CT-like protein, cortical thymocyte receptor (X. laevis CTX) like, cortical thymocyte-like protein,
• Gene location: 11q24.2 (124752254: 124747473)     Exons: 7     NC_000011.10
• OMIM: 605773

Protein Summary

• Protein general information: Q96IQ7  
  • Name: V set and immunoglobulin domain containing protein 2 (Cortical thymocyte like protein) (CT like protein)
  • Length: 327  
  • Mass: 34348
  • Tissue specificity: Highly expressed in stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. {ECO
• Sequence:

  MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPIL
  YFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLC
  SQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGS
  ASCELTLSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGGSDLREDAIAPGISEHTCMRA
  DSSKGFLERPSSASTVTTTKSKLPMVV

• Structural information:
  • Protein Domains: (24..13-)
    (/note="Ig-like-V-type)
    (144..23-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR042475  
  • Prosite: PS50835
  • STRING: ENSP00000318684
• Other Databases: GeneCards:  VSIG2  Malacards:  VSIG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq