• Gene id: 23539

Gene Summary

• Gene Symbol: SLC16A8   Gene   UCSC   Ensembl
• Aliases: MCT3, REMP
• Gene name: solute carrier family 16 member 8
• Alternate names: monocarboxylate transporter 3, MCT 3, solute carrier 16 (monocarboxylic acid transporters), member 8, solute carrier family 16 (monocarboxylate transporter), member 8, solute carrier family 16, member 8 (monocarboxylic acid transporter 3),
• Gene location: 22q13.1 (38084183: 38078136)     Exons: 6     NC_000022.11
• Gene summary(Entrez): SLC16A8 is a member of a family of proton-coupled monocarboxylate transporters that mediate lactate transport across cell membranes (Yoon et al., 1999 [PubMed 10493836]).[supplied by OMIM, Apr 2010]
• OMIM: 176946

Protein Summary

• Protein general information: O95907  
  • Name: Monocarboxylate transporter 3 (MCT 3) (Solute carrier family 16 member 8)
  • Length: 504  
  • Mass: 52319
  • Tissue specificity: Retinal pigment epithelium.
• Sequence:

  MGAGGPRRGEGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRALMRDFDAGYSDTAWVSSIMLAMLYGTGPVS
  SILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLTAGVLTGLGLALNFQPSLIMLGLYFERRRPLANGLAA
  AGSPVFLSALSPLGQQLLERFGWRGGFLLLGGLLLHCCACGAVMRPPPGPGPRPRRDSAGDRAGDAPGEAEADGA
  GLQLREASPRVRPRRRLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
  VARPACGALAGLARLRPHVPYLFSLALLANGLTDLSSARARSYGALVAFCVAFGLSYGMVGALQFEVLMAAVGAP
  RFPSALGLVLLVEAAAVLIGPPSAGRLVDVLKNYEIIFYLAGSEVALAGVFMAVATNCCLRCAKAAPSGPGTEGG
  ASDTEDAEAEGDSEPLPVVAEEPGNLEALEVLSARGEPTEPEIEARPRLAAESV

• Structural information:
  • Interpro: IPR004743  IPR030759  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000321735
• Other Databases: GeneCards:  SLC16A8  Malacards:  SLC16A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0015718	monocarboxylic acid transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0015129	lactate transmembrane transporter activity	IEA	molecular function
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015129	lactate transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015727	lactate transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035873	lactate transmembrane transport	IEA	biological process
GO:0035873	lactate transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq