• Gene id: 23533

Gene Summary

• Gene Symbol: PIK3R5   Gene   UCSC   Ensembl
• Aliases: F730038I15Rik, FOAP-2, P101-PI3K, p101
• Gene name: phosphoinositide-3-kinase regulatory subunit 5
• Alternate names: phosphoinositide 3-kinase regulatory subunit 5, PI3-kinase p101 subunit, phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, protein FOAP-2, ptdIns-3-kinase p101,
• Gene location: 17p13.1 (8965711: 8878915)     Exons: 20     NC_000017.11
• Gene summary(Entrez): Phosphatidylinositol 3-kinases (PI3Ks) phosphorylate the inositol ring of phosphatidylinositol at the 3-prime position, and play important roles in cell growth, proliferation, differentiation, motility, survival and intracellular trafficking. The PI3Ks ar
• OMIM: 607755

Protein Summary

• Protein general information: Q8WYR1  
  • Name: Phosphoinositide 3 kinase regulatory subunit 5 (PI3 kinase regulatory subunit 5) (PI3 kinase p101 subunit) (Phosphatidylinositol 4,5 bisphosphate 3 kinase regulatory subunit) (PtdIns 3 kinase regulatory subunit) (Protein FOAP 2) (PtdIns 3 kinase p101) (p1
  • Length: 880  
  • Mass: 97348
  • Tissue specificity: Ubiquitously expressed with high expression in fetal brain compared to adult brain. Abundant expression is observed in cerebellum, cerebral cortex, cerebral meninges, and vermis cerebelli. {ECO
• Sequence:

  MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQEKGTY
  DLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQG
  LPIRSHRSSTVTVLLLNPVEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAE
  LEDIFTETAEAQELASGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDI
  LQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLSLASSQASGPALSRHL
  LTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQKFIRIYKLFKSTSQLVLRRDSRSLEGSSDTA
  LPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSD
  RISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPW
  EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVY
  QTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKV
  CTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERK
  ILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP

• Structural information:
  • Interpro: IPR019522  
  • STRING: ENSP00000392812
• Other Databases: GeneCards:  PIK3R5  Malacards:  PIK3R5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043406	positive regulation of MAP kinase activity	ISS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:0031683	G-protein beta/gamma-subunit complex binding	ISS	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IEA	molecular function
GO:0005944	phosphatidylinositol 3-kinase complex, class IB	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IEA	molecular function
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04062	Chemokine signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04072	Phospholipase D signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04611	Platelet activation
hsa04725	Cholinergic synapse
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Ataxia with ocular apraxia	KEGG:H00848
Ataxia with ocular apraxia	KEGG:H00848
colon cancer	PMID:15123805
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq