• Gene id: 23508

Gene Summary

• Gene Symbol: TTC9   Gene   UCSC   Ensembl
• Aliases: TTC9A
• Gene name: tetratricopeptide repeat domain 9
• Alternate names: tetratricopeptide repeat protein 9A, TPR repeat protein 9A,
• Gene location: 14q24.2 (70641915: 70675365)     Exons: 3     NC_000014.9
• Gene summary(Entrez): This gene encodes a protein that contains three tetratricopeptide repeats. The gene has been shown to be hormonally regulated in breast cancer cells and may play a role in cancer cell invasion and metastasis. [provided by RefSeq, Mar 2009]
• OMIM: 610488

Protein Summary

• Protein general information: Q92623  
  • Name: Tetratricopeptide repeat protein 9A (TPR repeat protein 9A)
  • Length: 222  
  • Mass: 24379
• Sequence:

  MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKDKKFRE
  AIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQAELVNYERVK
  EYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMKLSRCSQREKEAM

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR013105  IPR019734  
  • Prosite: PS50005 PS50293
  • STRING: ENSP00000256367
• Other Databases: GeneCards:  TTC9  Malacards:  TTC9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060348	bone development	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R