• Gene id: 23452

Gene Summary

• Gene Symbol: ANGPTL2   Gene   UCSC   Ensembl
• Aliases: ARP2, HARP
• Gene name: angiopoietin like 2
• Alternate names: angiopoietin-related protein 2, angiopoietin-like protein 2,
• Gene location: 9q33.3 (127122683: 127087347)     Exons: 6     NC_000009.12
• Gene summary(Entrez): Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPT
• OMIM: 605001

Protein Summary

• Protein general information: Q9UKU9  
  • Name: Angiopoietin related protein 2 (Angiopoietin like protein 2)
  • Length: 493  
  • Mass: 57104
  • Tissue specificity: Widely expressed in heart, small intestine, spleen and stomach. Also found in lower levels in colon, ovary, adrenal gland, skeletal muscle and in prostate.
• Sequence:

  MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKE
  PEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRD
  NALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVY
  QPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTN
  RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGR
  KVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNG
  VWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

• Structural information:
  • Protein Domains: (269..48-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • DIP: 59886
  • STRING: ENSP00000362524
• Other Databases: GeneCards:  ANGPTL2  Malacards:  ANGPTL2

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq