• Gene id: 23446

Gene Summary

• Gene Symbol: SLC44A1   Gene   UCSC   Ensembl
• Aliases: CD92, CDW92, CHTL1, CONATOC, CTL1
• Gene name: solute carrier family 44 member 1
• Alternate names: choline transporter-like protein 1, CDW92 antigen, solute carrier family 44 (choline transporter), member 1,
• Gene location: 9q31.1-q31.2 (105244604: 105439774)     Exons: 19     NC_000009.12
• OMIM: 606105

Protein Summary

• Protein general information: Q8WWI5  
  • Name: Choline transporter like protein 1 (CDw92) (Solute carrier family 44 member 1) (CD antigen CD92)
  • Length: 657  
  • Mass: 73302
  • Tissue specificity: Expressed in various cells of the hematopoietic system. {ECO
• Sequence:

  MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSGYDSYGNICGQKNTK
  LEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYT
  TSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVL
  SMILMVIIRYISRVLVWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFT
  VILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWVYWIMTLLFLGTTGSPVQNEQGFVEF
  KISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDKRNLPFTPILASVNRLIRYHLGTVAKGSFII
  TLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVEN
  ALRVATINTVGDFMLFLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLC
  FAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASSA

• Structural information:
  • Interpro: IPR007603  
  • STRING: ENSP00000363852
• Other Databases: GeneCards:  SLC44A1  Malacards:  SLC44A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015220	choline transmembrane transporter activity	IDA	molecular function
GO:0015871	choline transport	IDA	biological process
GO:0015220	choline transmembrane transporter activity	IMP	molecular function
GO:0055085	transmembrane transport	IDA	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015871	choline transport	IMP	biological process
GO:0055085	transmembrane transport	IMP	biological process
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0015871	choline transport	IBA	biological process
GO:0015220	choline transmembrane transporter activity	IBA	molecular function
GO:0055085	transmembrane transport	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042426	choline catabolic process	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0006656	phosphatidylcholine biosynthetic process	TAS	biological process
GO:0015220	choline transmembrane transporter activity	TAS	molecular function
GO:0015220	choline transmembrane transporter activity	IEA	molecular function
GO:0015871	choline transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0015220	choline transmembrane transporter activity	TAS	molecular function
GO:0015871	choline transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05231	Choline metabolism in cancer

Diseases

Associated diseases	References
Malignant glioma	PMID:26671581
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq