• Gene id: 23430

Gene Summary

• Gene Symbol: TPSD1   Gene   UCSC   Ensembl
• Aliases: MCP7-LIKE, MCP7L1, MMCP-7L
• Gene name: tryptase delta 1
• Alternate names: tryptase delta, delta-tryptase, hmMCP-3-like tryptase III, mMCP-7-like delta II tryptase, mMCP-7-like-1, mMCP-7-like-2, mast cell tryptase, tryptase-3,
• Gene location: 16p13.3 (1256068: 1259007)     Exons: 5     NC_000016.10
• Gene summary(Entrez): Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes ar
• OMIM: 609272

Protein Summary

• Protein general information: Q9BZJ3  
  • Name: Tryptase delta (EC 3.4.21.59) (Delta tryptase) (HmMCP 3 like tryptase III) (Mast cell mMCP 7 like) (Tryptase 3)
  • Length: 242  
  • Mass: 26584
  • Tissue specificity: Expressed in colon, lung, heart and synovial tissue. May be specific to mast cells. {ECO
• Sequence:

  MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQW
  VLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLP
  PASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHD
  SCQGDSGGPLVCKVNGT

• Structural information:
  • Protein Domains: (38..24-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000211076
• Other Databases: GeneCards:  TPSD1  Malacards:  TPSD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881