• Gene id: 23367

Gene Summary

• Gene Symbol: LARP1   Gene   UCSC   Ensembl
• Aliases: LARP, Lar1, Lhp1
• Gene name: La ribonucleoprotein 1, translational regulator
• Alternate names: la-related protein 1, La ribonucleoprotein domain family member 1,
• Gene location: 5q33.2 (154682978: 154817604)     Exons: 27     NC_000005.10
• OMIM: 612059

Protein Summary

• Protein general information: Q6PKG0  
  • Name: La related protein 1 (La ribonucleoprotein domain family member 1)
  • Length: 1096  
  • Mass: 123510
• Sequence:

  MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERES
  PRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAP
  AKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKS
  DESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVA
  PPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGVEGPR
  TPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQAL
  TTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAV
  TPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQD
  EQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAEL
  AKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDAL
  ANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSN
  PPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNE
  RKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQ
  EETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEG
  RKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

• Structural information:
  • Protein Domains: (397..48-)
    RNA-binding (/note="HTH-La-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00332"-)
  • Interpro: IPR006607  IPR006630  IPR036388  IPR036390  
  • Prosite: PS50961
  • PDB: 4ZC4 5C0V 5V4R 5V7C 5V87 6PW3
  • PDBsum: 4ZC4 5C0V 5V4R 5V7C 5V87 6PW3
  • STRING: ENSP00000336721
• Other Databases: GeneCards:  LARP1  Malacards:  LARP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045948	positive regulation of translational initiation	IMP	biological process
GO:0031931	TORC1 complex	IDA	colocalizes with
GO:0031369	translation initiation factor binding	IDA	molecular function
GO:0031931	TORC1 complex	IDA	colocalizes with
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000340	RNA 7-methylguanosine cap binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0000339	RNA cap binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0005844	polysome	IDA	colocalizes with
GO:0042788	polysomal ribosome	IDA	colocalizes with
GO:0043024	ribosomal small subunit binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0017148	negative regulation of translation	IMP	biological process
GO:0072752	cellular response to rapamycin	IMP	biological process
GO:0045947	negative regulation of translational initiation	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0008494	translation activator activity	IMP	molecular function
GO:0008283	cell population proliferation	IMP	biological process
GO:0008190	eukaryotic initiation factor 4E binding	IPI	molecular function
GO:0006413	translational initiation	IMP	biological process
GO:0006413	translational initiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048255	mRNA stabilization	IMP	biological process
GO:0048027	mRNA 5'-UTR binding	IMP	molecular function
GO:1990928	response to amino acid starvation	IMP	biological process
GO:0038202	TORC1 signaling	IMP	biological process
GO:0048255	mRNA stabilization	IMP	biological process
GO:0006412	translation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016239	positive regulation of macroautophagy	IMP	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq