• Gene id: 23351

Gene Summary

• Gene Symbol: KHNYN   Gene   UCSC   Ensembl
• Aliases: KIAA0323
• Gene name: KH and NYN domain containing
• Alternate names: protein KHNYN,
• Gene location: 14q12 (24423185: 24441842)     Exons: 12     NC_000014.9
• Gene summary(Entrez): This gene encodes a protein containing a ribonuclease NYN domain. The function of this protein has yet to be determined. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
• OMIM: 0

Protein Summary

• Protein general information: O15037  
  • Name: Protein KHNYN (KH and NYN domain containing protein)
  • Length: 678  
  • Mass: 74534
• Sequence:

  MPTWGARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPKENASRAKEYLKGLCS
  PELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPRAPGSLMISGLTEAFVMAQSRVEELAERLSWDFTPGP
  SSGASQCTGVLRDFSALLQSPGDAHREALLQLPLAVQEELLSLVQEASSGQGPGALASWEGRSSALLGAQCQGVR
  APPSDGRESLDTGSMGPGDCRGARGDTYAVEKEGGKQGGPREMDWGWKELPGEEAWEREVALRPQSVGGGARESA
  PLKGKALGKEEIALGGGGFCVHREPPGAHGSCHRAAQSRGASLLQRLHNGNASPPRVPSPPPAPEPPWHCGDRGD
  CGDRGDVGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEALQDPFTLCLANVPGQPDLRHIVIDGSNVAMV
  HGLQHYFSSRGIAIAVQYFWDRGHRDITVFVPQWRFSKDAKVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDD
  RFMVKLAEETDGIIVSNDQFRDLAEESEKWMAIIRERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGS
  SKAQHPSRGFAEHGKQQQGREEEKGSGGIRKTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDINQLSEALLS
  LNF

• Structural information:
  • Interpro: IPR036612  IPR021869  
  • PDB: 2N5M 2N7K
  • PDBsum: 2N5M 2N7K
  • STRING: ENSP00000251343
• Other Databases: GeneCards:  KHNYN  Malacards:  KHNYN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0036464	cytoplasmic ribonucleoprotein granule	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IBA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)