• Gene id: 23252

Gene Summary

• Gene Symbol: OTUD3   Gene   UCSC   Ensembl
• Aliases: DUBA4
• Gene name: OTU deubiquitinase 3
• Alternate names: OTU domain-containing protein 3, OTU domain containing 3,
• Gene location: 1p36.13 (19881707: 19912944)     Exons: 8     NC_000001.11
• OMIM: 607614

Protein Summary

• Protein general information: Q5T2D3  
  • Name: OTU domain containing protein 3 (EC 3.4.19.12)
  • Length: 398  
  • Mass: 45124
• Sequence:

  MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGGGGGCEEEFVSFANQLQALGLKLREVPGDGN
  CLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNV
  VIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDESNKREKIKTKGMDSE
  DDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGPLWEE
  GGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAKVTNKQRREQQWMEKKKRQEERHRHKALESRGSHRD
  NNRSEAEANTQVTLVKTFAALNI

• Structural information:
  • Protein Domains: (65..18-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139-)
    (230..27-)
    (/note="UBA-like"-)
  • Interpro: IPR003323  IPR038765  
  • Prosite: PS50802
  • PDB: 4BOU
  • PDBsum: 4BOU
  • DIP: 61702
  • STRING: ENSP00000364261
• Other Databases: GeneCards:  OTUD3  Malacards:  OTUD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071108	protein K48-linked deubiquitination	IBA	biological process
GO:0044313	protein K6-linked deubiquitination	IBA	biological process
GO:1990167	protein K27-linked deubiquitination	IBA	biological process
GO:0050821	protein stabilization	IBA	biological process
GO:0035871	protein K11-linked deubiquitination	IBA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0044313	protein K6-linked deubiquitination	IDA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:1990167	protein K27-linked deubiquitination	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0071108	protein K48-linked deubiquitination	IDA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IDA	biological process
GO:0044313	protein K6-linked deubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq