• Gene id: 23233

Gene Summary

• Gene Symbol: EXOC6B   Gene   UCSC   Ensembl
• Aliases: SEC15B, SEC15L2, SEMDJL3
• Gene name: exocyst complex component 6B
• Alternate names: exocyst complex component 6B, SEC15 homolog B, SEC15-like protein 2, exocyst complex component Sec15B,
• Gene location: 2p13.2 (72826032: 72175983)     Exons: 28     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein which is a part of the evolutionarily conserved exocyst, a multimeric protein complex necessary for exocytosis, which in turn, is crucial for cell growth, polarity and migration. Disruption of this gene may be associated with p
• OMIM: 607880

Protein Summary

• Protein general information: Q9Y2D4  
  • Name: Exocyst complex component 6B (Exocyst complex component Sec15B) (SEC15 like protein 2)
  • Length: 811  
  • Mass: 94201
• Sequence:

  MERGKMAEAESLETAAEHERILREIESTDTACIGPTLRSVYDGEEHGRFMEKLETRIRNHDREIEKMCNFHYQGF
  VDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCRLQQRNISATVDKLMLCLPVLEMYSKLRDQ
  MKTKRHYPALKTLEHLEHTYLPQVSHYRFCKVMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMKQAQ
  QQRNLDNIVLQQPRIGSKRKSKKDAYIIFDTEIESTSPKSEQDSGILDVEDEEDDEEVPGAQDLVDFSPVYRCLH
  IYSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTTQGLVNRAYIDELWE
  MALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQLFDMLLEIRDQYSETLLKKWAGIFRNILD
  SDNYSPIPVTSEEMYKKVVGQFPFQDIELEKQPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDM
  IRKSTNLLLTRTLSNSLQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHTTKLYGTTTFK
  DARHAAEEEIYTNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPGKVAQTACMSACKHL
  ATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQEDTLQLAFIDLRQLLDLFIQWDWSTYLADYG
  QPNCKYLRVNPVTALTLLEKMKDTSRKNNMFAQFRKNERDKQKLIDTVAKQLRGLISSHHS

• Structural information:
  • Interpro: IPR007225  IPR042045  
  • STRING: ENSP00000272427
• Other Databases: GeneCards:  EXOC6B  Malacards:  EXOC6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000145	exocyst	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0006893	Golgi to plasma membrane transport	IBA	biological process
GO:0000145	exocyst	IEA	cellular component
GO:0006904	vesicle docking involved in exocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R