• Gene id: 23220

Gene Summary

• Gene Symbol: DTX4   Gene   UCSC   Ensembl
• Aliases: RNF155
• Gene name: deltex E3 ubiquitin ligase 4
• Alternate names: E3 ubiquitin-protein ligase DTX4, RING finger protein 155, RING-type E3 ubiquitin transferase DTX4, deltex 4 homolog, deltex 4, E3 ubiquitin ligase, deltex homolog 4, deltex4, protein deltex-4,
• Gene location: 11q12.1 (59171429: 59208587)     Exons: 11     NC_000011.10
• OMIM: 606653

Protein Summary

• Protein general information: Q9Y2E6  
  • Name: E3 ubiquitin protein ligase DTX4 (EC 2.3.2.27) (Protein deltex 4) (Deltex4) (RING finger protein 155) (RING type E3 ubiquitin transferase DTX4)
  • Length: 619  
  • Mass: 67258
• Sequence:

  MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRP
  VRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQ
  RRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPG
  VVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRL
  AIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNT
  SRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLV
  AMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSA
  RGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNV
  LAELAAQGISEDSTAQEKD

• Structural information:
  • Protein Domains: (1..7-)
    (/note="WWE-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00248-)
    (79..15-)
    (/note="WWE-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00248"-)
  • Interpro: IPR039396  IPR039399  IPR039398  IPR004170  IPR018123   IPR037197  IPR018957  IPR001841  IPR013083  
  • Prosite: PS50918 PS50089
  • CDD: cd09633
  • STRING: ENSP00000227451
• Other Databases: GeneCards:  DTX4  Malacards:  DTX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0007219	Notch signaling pathway	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray