• Gene id: 23179

Gene Summary

• Gene Symbol: RGL1   Gene   UCSC   Ensembl
• Aliases: RGL
• Gene name: ral guanine nucleotide dissociation stimulator like 1
• Alternate names: ral guanine nucleotide dissociation stimulator-like 1, ralGDS-like 1,
• Gene location: 1q25.3 (183636093: 183928542)     Exons: 4     NC_000001.11
• OMIM: 605667

Protein Summary

• Protein general information: Q9NZL6  
  • Name: Ral guanine nucleotide dissociation stimulator like 1 (RalGDS like 1)
  • Length: 768  
  • Mass: 86701
  • Tissue specificity: Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis.
• Sequence:

  MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQYETCKIRTIKAGTLE
  KLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTSPNCEEDGSQSSSESKMVIRNAIASILRA
  WLDQCAEDFREPPHFPCLQKLLDYLTRMMPGSDPERRAQNLLEQFQKQEVETDNGLPNTISFSLEEEEELEGGES
  AEFTCFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRDKKENKHLAPTIRATISQFNTLTKCVVSTILGGKEL
  KTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEELSDIFSDHNNHLTSR
  ELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYIEGGLINFEKRRR
  EFEVIAQIKLLQSACNSYCMTPDQKFIQWFQRQQLLTEEESYALSCEIEAAADASTTSPKPRKSMVKRLSLLFLG
  SDMITSPTPTKEQPKSTASGSSGESMDSVSVSSCESNHSEAEEGSITPMDTPDEPQKKLSESSSSCSSIHSMDTN
  SSGMSSLINPLSSPPSCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNNGNMYKSIMLTSQDKT
  PAVIQRAMLKHNLDSDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKNSMEEQVKLRSRTSLTL
  PRTAKRGCWSNRHSKITL

• Structural information:
  • Protein Domains: (65..19-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (232..50-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (648..73-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSIT-)
  • Interpro: IPR000159  IPR008937  IPR000651  IPR019804  IPR023578   IPR001895  IPR036964  IPR030748  IPR029071  
  • Prosite: PS50200 PS00720 PS50009 PS50212
  • CDD: cd00155 cd06224
  • DIP: 31372
  • STRING: ENSP00000303192
• Other Databases: GeneCards:  RGL1  Malacards:  RGL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0008321	Ral guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007264	small GTPase mediated signal transduction	NAS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0008321	Ral guanyl-nucleotide exchange factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)