• Gene id: 23139

Gene Summary

• Gene Symbol: MAST2   Gene   UCSC   Ensembl
• Aliases: MAST205, MTSSK
• Gene name: microtubule associated serine/threonine kinase 2
• Alternate names: microtubule-associated serine/threonine-protein kinase 2, microtubule associated testis specific serine/threonine protein kinase,
• Gene location: 1p34.1 (45786991: 46036123)     Exons: 39     NC_000001.11
• OMIM: 612257

Protein Summary

• Protein general information: Q6P0Q8  
  • Name: Microtubule associated serine/threonine protein kinase 2 (EC 2.7.11.1)
  • Length: 1798  
  • Mass: 196,436
• Sequence:

  MKRSRCRDRPQPPPPDRREDGVQRAAELSQSLPPRRRAPPGRQRLEERTGPAGPEGKEQDVVTGVSPLLFRKLSN
  PDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQSLGQSAP
  SLTAGLKELSLPRRGSFCRTSNRKSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTD
  GRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTESVPDEEGRQSPAMRPRSRSL
  SPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPLADGALSFIHHQVIEMARDCLDKSRS
  GLITSQYFYELQDNLEKLLQDAHERSESSEVAFVMQLVKKLMIIIARPARLLECLEFDPEEFYHLLEAAEGHAKE
  GQGIKCDIPRYIVSQLGLTRDPLEEMAQLSSCDSPDTPETDDSIEGHGASLPSKKTPSEEDFETIKLISNGAYGA
  VFLVRHKSTRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATL
  LKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMSLTTNLYEGHIEK
  DAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDEA
  LPPDAQDLTSKLLHQNPLERLGTGSAYEVKQHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHMDS
  EDEEEVSEDGCLEIRQFSSCSPRFNKVYSSMERLSLLEERRTPPPTKRSLSEEKEDHSDGLAGLKGRDRSWVIGS
  PEILRKRLSVSESSHTESDSSPPMTVRRRCSGLLDAPRFPEGPEEASSTLRRQPQEGIWVLTPPSGEGVSGPVTE
  HSGEQRPKLDEEAVGRSSGSSPAMETRGRGTSQLAEGATAKAISDLAVRRARHRLLSGDSTEKRTARPVNKVIKS
  ASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSRDSSPSRDFLPALGSMRPPIIIHRAGKKYGFTLRAIRVYM
  GDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLENTSIKVGP
  ARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGESGPGSPTHSHSLSPRS
  PTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAGSGHTRPSSLHGLAPKLQRQYRSPRRKSAGSIPLSPLAHTP
  SPPPPTASPQRSPSPLSGHVAQAFPTKLHLSPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAASEKKLATS
  RKHSLDLPHSELKKELPPREVSPLEVVGARSVLSGKGALPGKGVLQPAPSRALGTLRQDRAERRESLQKQEAIRE
  VDSSEDDTEEGPENSQGAQELSLAPHPEVSQSVAPKGAGESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMES
  PSGPHRRLGSPQAIEEAASSSSAGPNLGQSGATDPIPPEGCWKAQHLHTQALTALSPSTSGLTPTSSCSPPSSTS
  GKLSMWSWKSLIEGPDRASPSRKATMAGGLANLQDLENTTPAQPKNLSPREQGKTQPPSAPRLAHPSYEDPSQGW
  LWESECAQAVKEDPALSITQVPDASGDRRQDVPCRGCPLTQKSEPSLRRGQEPGGHQKHRDLALVPDELLKQT

• Structural information:
  • Protein Domains: Protein (512-785)
    AGC-kinase (786-854)
    PDZ. (1104-1192)
  • Interpro: IPR000961  IPR011009  IPR015022  IPR037711  IPR028779   IPR023142  IPR001478  IPR036034  IPR000719  IPR008271  
  • Prosite: PS51285 PS50106 PS50011 PS00108
  • CDD: cd05609
  • PDB: 2KQF 2KYL
  • PDBsum: 2KQF 2KYL
  • STRING: ENSP00000354671
• Other Databases: GeneCards:  MAST2  Malacards:  MAST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0045075	regulation of interleukin-12 biosynthetic process	ISS	biological process
GO:0048515	spermatid differentiation	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0045075	regulation of interleukin-12 biosynthetic process	IEA	biological process
GO:0045075	regulation of interleukin-12 biosynthetic process	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048515	spermatid differentiation	ISS	biological process
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0045075	regulation of interleukin-12 biosynthetic process	ISS	biological process
GO:0048515	spermatid differentiation	ISS	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 26203179
Associated with spermatid maturation	MIK: 8902215
Nonobstructive Azoospermia	MIK: 26203179
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26203179	Nonobstructive Azoospermia		Han Chi nese	5678 (2427 nonobstructive azoospermia, 3251 controls)	Male infertility
8902215	Associated with spermatid maturation				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R