• Gene id: 23097

Gene Summary

• Gene Symbol: CDK19   Gene   UCSC   Ensembl
• Aliases: CDC2L6, CDK11, bA346C16.3
• Gene name: cyclin dependent kinase 19
• Alternate names: cyclin-dependent kinase 19, CDC2-related protein kinase 6, CDK8-like cyclin-dependent kinase, cell division cycle 2-like 6 (CDK8-like), cell division cycle 2-like protein kinase 6, cell division protein kinase 19, cyclin dependent kinase 19 variant 2, cyclin-dep,
• Gene location: 6q21 (110816530: 110609977)     Exons: 22     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polyme
• OMIM: 614720

Protein Summary

• Protein general information: Q9BWU1  
  • Name: Cyclin dependent kinase 19 (EC 2.7.11.22) (CDC2 related protein kinase 6) (Cell division cycle 2 like protein kinase 6) (Cell division protein kinase 19) (Cyclin dependent kinase 11) (Death preventing kinase)
  • Length: 502  
  • Mass: 56802
• Sequence:

  MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKH
  PNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHR
  DLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFA
  ELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
  KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQ
  QNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSG
  GPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY

• Structural information:
  • Protein Domains: (21..33-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • DIP: 29013
  • STRING: ENSP00000357907
• Other Databases: GeneCards:  CDK19  Malacards:  CDK19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IBA	cellular component
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)