• Gene id: 23087

Gene Summary

• Gene Symbol: TRIM35   Gene   UCSC   Ensembl
• Aliases: HLS5, MAIR
• Gene name: tripartite motif containing 35
• Alternate names: tripartite motif-containing protein 35, hemopoietic lineage switch protein 5,
• Gene location: 8p21.2 (27311271: 27284885)     Exons: 7     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identifi
• OMIM: 604282

Protein Summary

• Protein general information: Q9UPQ4  
  • Name: Tripartite motif containing protein 35 (Hemopoietic lineage switch protein 5)
  • Length: 493  
  • Mass: 56540
• Sequence:

  MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTL
  NNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRN
  MEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMK
  QLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE
  SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEVALGGLQSWRVGVVRV
  RQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL
  YTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG

• Structural information:
  • Protein Domains: (284..48-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000301924
• Other Databases: GeneCards:  TRIM35  Malacards:  TRIM35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray