• Gene id: 23038

Gene Summary

• Gene Symbol: WDTC1   Gene   UCSC   Ensembl
• Aliases: ADP, DCAF9
• Gene name: WD and tetratricopeptide repeats 1
• Alternate names: WD and tetratricopeptide repeats protein 1, DDB1 and CUL4 associated factor 9, adipose homolog,
• Gene location: 1p36.11 (27234612: 27308635)     Exons: 7     NC_000001.11

Protein Summary

• Protein general information: Q8N5D0  
  • Name: WD and tetratricopeptide repeats protein 1
  • Length: 677  
  • Mass: 75920
• Sequence:

  MAKVNITRDLIRRQIKERGALSFERRYHVTDPFIRRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDDQHTIVWD
  PLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHDLTVKETIHMFGDHTNRVKRIATAPMWPNTF
  WSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMK
  QSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTYK
  QRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVKQQANEAFAC
  QQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYDALRDCLKAISLNPCHLKAHFRLARCLFELKYVA
  EALECLDDFKGKFPEQAHSSACDALGRDITAALFSKNDGEEKKGPGGGAPVRLRSTSRKDSISEDEMVLRERSYD
  YQFRYCGHCNTTTDIKEANFFGSNAQYIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGI
  DPVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNADPLEVMLLNMGYRITGLSSGGAGASDDEDSSEGQVQCR
  PS

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR019734  IPR015943  IPR001680   IPR017986  IPR036322  
  • Prosite: PS50293 PS50082 PS50294
  • PDB: 3I7N
  • PDBsum: 3I7N
  • DIP: 31627
  • STRING: ENSP00000317971
• Other Databases: GeneCards:  WDTC1  Malacards:  WDTC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0045717	negative regulation of fatty acid biosynthetic process	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0045717	negative regulation of fatty acid biosynthetic process	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0008361	regulation of cell size	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0055082	cellular chemical homeostasis	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0035264	multicellular organism growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq