• Gene id: 23032

Gene Summary

• Gene Symbol: USP33   Gene   UCSC   Ensembl
• Aliases: VDU1
• Gene name: ubiquitin specific peptidase 33
• Alternate names: ubiquitin carboxyl-terminal hydrolase 33, VHL-interacting deubiquitinating enzyme 1, deubiquitinating enzyme 33, pVHL-interacting deubiquitinating enzyme 1, ubiquitin thioesterase 33, ubiquitin thiolesterase 33, ubiquitin-specific-processing protease 33,
• Gene location: 1p31.1 (77759851: 77695986)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene encodes a deubiquinating enzyme important in a variety of processes, including Slit-dependent cell migration and beta-2 adrenergic receptor signaling. The protein is negatively regulated through ubiquitination by von Hippel-Lindau tumor protein
• OMIM: 615146

Protein Summary

• Protein general information: Q8TEY7  
  • Name: Ubiquitin carboxyl terminal hydrolase 33 (EC 3.4.19.12) (Deubiquitinating enzyme 33) (Ubiquitin thioesterase 33) (Ubiquitin specific processing protease 33) (VHL interacting deubiquitinating enzyme 1) (hVDU1)
  • Length: 942  
  • Mass: 106727
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACL
  ENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDF
  KIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKK
  PAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT
  ITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKV
  NSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGL
  APPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPT
  SIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGV
  KFCKVQNFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYI
  AYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKF
  KTFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRK
  TELEIFIRLNRAFQKEDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEE
  TWNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL

• Structural information:
  • Protein Domains: (185..71-)
    (/note="USP-)
    (717..81-)
    (/note="DUSP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00613-)
    (818..92-)
    (/note="DUSP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00613"-)
  • Interpro: IPR035927  IPR038765  IPR006615  IPR001394  IPR018200   IPR028889  IPR013083  IPR001607  
  • Prosite: PS51283 PS00972 PS00973 PS50235 PS50271
  • PDB: 2UZG
  • PDBsum: 2UZG
  • DIP: 48942
  • STRING: ENSP00000359829
• Other Databases: GeneCards:  USP33  Malacards:  USP33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050821	protein stabilization	IMP	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0070536	protein K63-linked deubiquitination	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0071108	protein K48-linked deubiquitination	IDA	biological process
GO:0043130	ubiquitin binding	IDA	NOT|molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0051298	centrosome duplication	IMP	biological process
GO:0016477	cell migration	ISS	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0007411	axon guidance	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0016477	cell migration	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016579	protein deubiquitination	IDA	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0016579	protein deubiquitination	IMP	biological process
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030891	VCB complex	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0010506	regulation of autophagy	IMP	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq