• Gene id: 23008

Gene Summary

• Gene Symbol: KLHDC10   Gene   UCSC   Ensembl
• Aliases: slim
• Gene name: kelch domain containing 10
• Alternate names: kelch domain-containing protein 10, PNAS-119, scruin like at the midline homolog,
• Gene location: 7q32.2 (130070531: 130135704)     Exons: 10     NC_000007.14
• OMIM: 615152

Protein Summary

• Protein general information: Q6PID8  
  • Name: Kelch domain containing protein 10
  • Length: 442  
  • Mass: 49098
• Sequence:

  MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKIRWDPVRRRFIQSCPI
  IRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGPDNEDYPLFRELWRYHFATGVWHQMGTDGYM
  PRELASMSLVLHGNNLLVFGGTGIPFGESNGNDVHVCNVKYKRWALLSCRGKKPSRIYGQAMAIINGSLYVFGGT
  TGYIYSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWE
  EIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKLPATMPEPVYFHCAAVTPAG
  CMYIHGGVVNIHENKRTGSLFKIWLVVPSLLELAWEKLLAAFPNLANLSRTQLLHLGLTQGLIERLK

• Structural information:
  • Interpro: IPR015915  IPR006652  
  • STRING: ENSP00000334140
• Other Databases: GeneCards:  KLHDC10  Malacards:  KLHDC10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032874	positive regulation of stress-activated MAPK cascade	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq