• Gene id: 22998

Gene Summary

• Gene Symbol: LIMCH1   Gene   UCSC   Ensembl
• Aliases: LIMCH1A, LMO7B
• Gene name: LIM and calponin homology domains 1
• Alternate names: LIM and calponin homology domains-containing protein 1,
• Gene location: 4p13 (41359606: 41700043)     Exons: 38     NC_000004.12
• OMIM: 608375

Protein Summary

• Protein general information: Q9UPQ0  
  • Name: LIM and calponin homology domains containing protein 1
  • Length: 1083  
  • Mass: 121867
• Sequence:

  MACPALGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNAIKPGLVKKINRLPTP
  IAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYSRKLKNVLVTIYWLGKAANSCTSYSGTTLNL
  KEFEGLLAQMRKDTDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRGS
  SDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYVPAPLRKKKAEREEYRKSWST
  ATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQLQLINNQLREEDDKWQDDLARWKSRR
  RSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKERRERELHEAYKNARSQEEAEGILQQYIERF
  TISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASVLDTSMSAGSGSPS
  KTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKVSVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHG
  SPLELKQDNGSIEINIKKPNSVPQELAATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAF
  VEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVLSQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQVDS
  PSSEKSPVMTPQFKFWAWDPEEERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKII
  EDTVVPFTVSSSSADQLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLT
  EGALAHSGNPVSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKTLPLDKSINHQIESPS
  ERRKKSPREHFQAGPFSPCSPTPPGQSPNRSISGKKLCSSCGLPLGKGAAMIIETLNLYFHIQCFRCGICKGQLG
  DAVSGTDVRIRNGLLNCNDCYMRSRSAGQPTTL

• Structural information:
  • Protein Domains: (21..12-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (1011..107-)
    (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001997  IPR001715  IPR036872  IPR031865  IPR029980   IPR003096  IPR001781  
  • Prosite: PS50021 PS00478 PS50023
  • CDD: cd00014
  • STRING: ENSP00000316891
• Other Databases: GeneCards:  LIMCH1  Malacards:  LIMCH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001725	stress fiber	IDA	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0060327	cytoplasmic actin-based contraction involved in cell motility	IMP	biological process
GO:0016460	myosin II complex	IBA	colocalizes with
GO:0032034	myosin II head/neck binding	IBA	molecular function
GO:0051496	positive regulation of stress fiber assembly	IBA	biological process
GO:0001725	stress fiber	IBA	cellular component
GO:0051893	regulation of focal adhesion assembly	IBA	biological process
GO:0016460	myosin II complex	IDA	colocalizes with
GO:0032034	myosin II head/neck binding	IDA	molecular function
GO:0001725	stress fiber	IDA	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0032034	myosin II head/neck binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0051893	regulation of focal adhesion assembly	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0031032	actomyosin structure organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0060327	cytoplasmic actin-based contraction involved in cell motility	IMP	biological process
GO:0016460	myosin II complex	IBA	colocalizes with
GO:0032034	myosin II head/neck binding	IBA	molecular function
GO:0051496	positive regulation of stress fiber assembly	IBA	biological process
GO:0001725	stress fiber	IBA	cellular component
GO:0051893	regulation of focal adhesion assembly	IBA	biological process
GO:0016460	myosin II complex	IDA	colocalizes with
GO:0032034	myosin II head/neck binding	IDA	molecular function
GO:0001725	stress fiber	IDA	cellular component
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0032034	myosin II head/neck binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0051893	regulation of focal adhesion assembly	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0031032	actomyosin structure organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray