Search Result
| Gene id | 22949 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PTGR1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | LTB4DH, PGR1, ZADH3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | prostaglandin reductase 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | prostaglandin reductase 1, 15-oxoprostaglandin 13-reductase, NADP-dependent leukotriene B4 12-hydroxydehydrogenase, PRG-1, leukotriene B4 12-hydroxydehydrogenase, zinc binding alcohol dehydrogenase domain containing 3, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
9q31.3 (111599854: 111549721) Exons: 14 NC_000009.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 601274 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q14914 Name: Prostaglandin reductase 1 (PRG 1) (EC 1.3.1. ) (15 oxoprostaglandin 13 reductase) (EC 1.3.1.48) (NADP dependent leukotriene B4 12 hydroxydehydrogenase) (EC 1.3.1.74) Length: 329 Mass: 35870 Tissue specificity: High expression in the kidney, liver, and intestine but not in leukocytes. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESK NVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAA AGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNT VIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE YIIEGFENMPAAFMGMLKGDNLGKTIVKA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PTGR1  Malacards: PTGR1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||